PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P27060_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 802aa    MW: 88144.7 Da    PI: 5.2391
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P27060_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-17657711256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++t+eq   Le+ F+++ +++ ++++ LAk l+L  rqV vWFqNrRa+ k
  GSMUA_Achr1P27060_001 657 RKKLRLTREQSALLEDRFKEHTTLNPKQKQALAKDLNLRPRQVEVWFQNRRARTK 711
                            678899***********************************************98 PP

2HD-ZIP_I/II120.11.1e-38657746191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl++eq++lLE+ F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk++y+al++en+rL+ke +eL+
  GSMUA_Achr1P27060_001 657 RKKLRLTREQSALLEDRFKEHTTLNPKQKQALAKDLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCYEALTNENQRLHKELQELK 744
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  GSMUA_Achr1P27060_001 745 -AL 746
                            .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR031561.4E-87143451IPR016496GTPase HflX
PfamPF131678.5E-12143210IPR025121GTPase HflX, N-terminal
PfamPF163605.3E-18213309IPR032305GTP-binding protein, middle domain
CDDcd018789.84E-72294450No hitNo description
SuperFamilySSF525403.31E-29320452IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS5170553.855321449IPR030394HflX-type guanine nucleotide-binding (G) domain
Gene3DG3DSA:3.40.50.3005.8E-25321452IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF019269.7E-16323444IPR006073GTP binding domain
PRINTSPR003269.2E-7323343IPR006073GTP binding domain
PRINTSPR003269.2E-7390408IPR006073GTP binding domain
Gene3DG3DSA:1.10.10.609.5E-18633714IPR009057Homeodomain-like
SuperFamilySSF466891.28E-17641714IPR009057Homeodomain-like
PROSITE profilePS5007117.281653713IPR001356Homeobox domain
SMARTSM003892.2E-15655717IPR001356Homeobox domain
PfamPF000465.0E-15657711IPR001356Homeobox domain
CDDcd000862.30E-15657714No hitNo description
PROSITE patternPS000270688711IPR017970Homeobox, conserved site
SMARTSM003404.3E-20713756IPR003106Leucine zipper, homeobox-associated
PfamPF021834.7E-11713747IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005525Molecular FunctionGTP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
MLHLRVITRL RTPLRSLPRI LLTPFSSPPP PSPPFLRPPP PISPPSAPFS TTSSSRRRRG  60
GGDAEADESD GAGVSLFGRD PTHPPKLFVV QPRLRPDSLL HSKLSEALNL ANSLEERRDG  120
VFAEDYGSKE PPPHLVVQNP GARSLRVHSD TYFGRGTVEN VKCELRALVT ENAIDAIFVN  180
AILSGIQQRN LEVSWQKPVL DRIGLIIEIF NAHAETKEAK LQSELAALMY KRTRLVRVRG  240
PGGRMTFGTS GEAEVVSARG RGSGGRGFIS GAGETELQLQ RRRIQERRIH ILSQIEEVRR  300
TRSLQRYARR RHGSSYGQGL ATVAVVGYTN AGKSTLVSAL SESDLYSDDR LFATVDPRVR  360
SVVLPSGKKA LLSDTVGFIS DLPVQLVEAF HATLEEVVEA DLLVHVLDSS SPDLDAQREA  420
VLQVLQQLGV SGEKIKNMIE VWNKIDLLES NGGADECFGE EEIIGEDEEE YPEDDMTCDP  480
SSGKPVDEDD DAMASEFSQE ESLDNADDVA SEFSCGEHMD DNDDYDDGDI ASDVSTEETT  540
KRLQNSRLLL KVESQAWMDM DPHDTFDTDL SLGLGIGPAS TASADDCRRR QRGCCSPCTN  600
LFPDEPSLSL SLSDDASGGG RTMQKAEADR PAQLSSSRSA ASSFSSAADE EENSSGRKKL  660
RLTREQSALL EDRFKEHTTL NPKQKQALAK DLNLRPRQVE VWFQNRRART KLKQTEVDCE  720
FLKKCYEALT NENQRLHKEL QELKALKFAQ PLLHMQLPSA AAPLTMCPSC QRISGGGGDA  780
KDSSKAPKPG HCLNPFSHSA AC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ady_66e-4313644933323GTPASE HFLX
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1705713RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009419690.10.0PREDICTED: GTP-binding protein At3g49725, chloroplastic
SwissprotQ0WTB41e-152Y3725_ARATH; GTP-binding protein At3g49725, chloroplastic
TrEMBLM0S3G30.0M0S3G3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P27060_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.14e-55HD-ZIP family protein